Lineage for d1nhcc_ (1nhc C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813492Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813493Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2813550Family b.80.1.3: Galacturonase [51137] (3 proteins)
    this is a repeat family; one repeat unit is 1bhe A:244-269 found in domain
  6. 2813551Protein Polygalacturonase [51140] (6 species)
  7. 2813558Species Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId:5061] [101950] (1 PDB entry)
  8. 2813561Domain d1nhcc_: 1nhc C: [91881]
    complexed with gol, man, nag, so4

Details for d1nhcc_

PDB Entry: 1nhc (more details), 1.7 Å

PDB Description: structural insights into the processivity of endopolygalacturonase i from aspergillus niger
PDB Compounds: (C:) Polygalacturonase I

SCOPe Domain Sequences for d1nhcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhcc_ b.80.1.3 (C:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]}
stctftsaseasesisscsdvvlssievpagetldlsdaadgstitfegttsfgykewkg
plirfggkdltvtmadgavidgdgsrwwdskgtnggktkpkfmyihdvedstfkginikn
tpvqaisvqatnvhlndftidnsdgddngghntdgfdisestgvyisgatvknqddciai
nsgesisftggtcsgghglsigsvggrddntvknvtisdstvsnsangvriktiyketgd
vseitysniqlsgitdygivieqdyengsptgtpstgipitdvtvdgvtgtleddatqvy
ilcgdgscsdwtwsgvdlsggktsdkcenvpsgasc

SCOPe Domain Coordinates for d1nhcc_:

Click to download the PDB-style file with coordinates for d1nhcc_.
(The format of our PDB-style files is described here.)

Timeline for d1nhcc_: