Lineage for d1nhcb_ (1nhc B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402886Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2402887Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2402942Family b.80.1.3: Galacturonase [51137] (3 protein domains)
  6. 2402943Protein Polygalacturonase [51140] (6 species)
  7. 2402950Species Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId:5061] [101950] (1 PDB entry)
  8. 2402952Domain d1nhcb_: 1nhc B: [91880]
    complexed with gol, man, nag, so4

Details for d1nhcb_

PDB Entry: 1nhc (more details), 1.7 Å

PDB Description: Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger
PDB Compounds: (B:) Polygalacturonase I

SCOPe Domain Sequences for d1nhcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhcb_ b.80.1.3 (B:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]}
stctftsaseasesisscsdvvlssievpagetldlsdaadgstitfegttsfgykewkg
plirfggkdltvtmadgavidgdgsrwwdskgtnggktkpkfmyihdvedstfkginikn
tpvqaisvqatnvhlndftidnsdgddngghntdgfdisestgvyisgatvknqddciai
nsgesisftggtcsgghglsigsvggrddntvknvtisdstvsnsangvriktiyketgd
vseitysniqlsgitdygivieqdyengsptgtpstgipitdvtvdgvtgtleddatqvy
ilcgdgscsdwtwsgvdlsggktsdkcenvpsgasc

SCOPe Domain Coordinates for d1nhcb_:

Click to download the PDB-style file with coordinates for d1nhcb_.
(The format of our PDB-style files is described here.)

Timeline for d1nhcb_: