Lineage for d1nh9a_ (1nh9 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726532Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 726672Superfamily d.68.6: AlbA-like [82704] (2 families) (S)
  5. 726673Family d.68.6.1: DNA-binding protein AlbA [82705] (1 protein)
  6. 726674Protein DNA-binding protein AlbA [82706] (4 species)
    an archaeal chromatin protein modulated by acetylation, a Sir2 substrate
  7. 726679Species Archaeon Methanococcus jannaschii [TaxId:2190] [103060] (1 PDB entry)
  8. 726680Domain d1nh9a_: 1nh9 A: [91878]

Details for d1nh9a_

PDB Entry: 1nh9 (more details), 2 Å

PDB Description: Crystal Structure of a DNA Binding Protein Mja10b from the hyperthermophile Methanococcus jannaschii
PDB Compounds: (A:) DNA-binding protein Alba

SCOP Domain Sequences for d1nh9a_:

Sequence, based on SEQRES records: (download)

>d1nh9a_ d.68.6.1 (A:) DNA-binding protein AlbA {Archaeon Methanococcus jannaschii [TaxId: 2190]}
mdnvvligkkpvmnyvvavltqltsndeviikargkainkavdvaemirnrfikdikikk
ieigtdkvknpdgrevnvstieivlak

Sequence, based on observed residues (ATOM records): (download)

>d1nh9a_ d.68.6.1 (A:) DNA-binding protein AlbA {Archaeon Methanococcus jannaschii [TaxId: 2190]}
mdnvvligkkpvmnyvvavltqltsndeviikargkainkavdvaemirnrfikdikikk
ieigtdkevnvstieivlak

SCOP Domain Coordinates for d1nh9a_:

Click to download the PDB-style file with coordinates for d1nh9a_.
(The format of our PDB-style files is described here.)

Timeline for d1nh9a_: