Lineage for d1nh2a2 (1nh2 A:156-240)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610723Fold d.129: TBP-like [55944] (9 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 610724Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 610725Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
  6. 610726Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 610792Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (6 PDB entries)
  8. 610794Domain d1nh2a2: 1nh2 A:156-240 [91873]
    Other proteins in same PDB: d1nh2b_, d1nh2c_, d1nh2d1, d1nh2d2
    complexed with 5iu

Details for d1nh2a2

PDB Entry: 1nh2 (more details), 1.9 Å

PDB Description: crystal structure of a yeast tfiia/tbp/dna complex

SCOP Domain Sequences for d1nh2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nh2a2 d.129.1.1 (A:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt
gakqreeiyqafeaiypvlsefrkm

SCOP Domain Coordinates for d1nh2a2:

Click to download the PDB-style file with coordinates for d1nh2a2.
(The format of our PDB-style files is described here.)

Timeline for d1nh2a2: