![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) ![]() |
![]() | Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats automatically mapped to Pfam PF00352 |
![]() | Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries) |
![]() | Domain d1nh2a1: 1nh2 A:61-155 [91872] Other proteins in same PDB: d1nh2b_, d1nh2c_, d1nh2d1, d1nh2d2 protein/DNA complex |
PDB Entry: 1nh2 (more details), 1.9 Å
SCOPe Domain Sequences for d1nh2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nh2a1 d.129.1.1 (A:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk mvvtgakseddsklasrkyariiqkigfaakftdf
Timeline for d1nh2a1:
![]() Domains from other chains: (mouse over for more information) d1nh2b_, d1nh2c_, d1nh2d1, d1nh2d2 |