Lineage for d1ng5b_ (1ng5 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1811566Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 1811567Superfamily b.100.1: Sortase [63817] (1 family) (S)
  5. 1811568Family b.100.1.1: Sortase [63818] (3 proteins)
  6. 1811587Protein Sortase B [101879] (1 species)
  7. 1811588Species Staphylococcus aureus [TaxId:1280] [101880] (4 PDB entries)
  8. 1811591Domain d1ng5b_: 1ng5 B: [91868]

Details for d1ng5b_

PDB Entry: 1ng5 (more details), 2 Å

PDB Description: 2.0 a crystal structure of staphylococcus aureus sortase b
PDB Compounds: (B:) sortase B

SCOPe Domain Sequences for d1ng5b_:

Sequence, based on SEQRES records: (download)

>d1ng5b_ b.100.1.1 (B:) Sortase B {Staphylococcus aureus [TaxId: 1280]}
qeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgktnh
dylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfyekh
kiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdvnvtv
kdkimtlstcedaysettkrivvvakiikvs

Sequence, based on observed residues (ATOM records): (download)

>d1ng5b_ b.100.1.1 (B:) Sortase B {Staphylococcus aureus [TaxId: 1280]}
qeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgktnh
dylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfyekh
kiiefdnkygkyqlqvfsaykttirtdfendqdyqqfldetkrksvinsdvnvtvkdkim
tlstcedaysettkrivvvakiikvs

SCOPe Domain Coordinates for d1ng5b_:

Click to download the PDB-style file with coordinates for d1ng5b_.
(The format of our PDB-style files is described here.)

Timeline for d1ng5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ng5a_