Lineage for d1ng5a_ (1ng5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820736Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 2820737Superfamily b.100.1: Sortase [63817] (2 families) (S)
  5. 2820738Family b.100.1.1: Sortase [63818] (3 proteins)
  6. 2820759Protein Sortase B [101879] (1 species)
  7. 2820760Species Staphylococcus aureus [TaxId:1280] [101880] (4 PDB entries)
  8. 2820762Domain d1ng5a_: 1ng5 A: [91867]

Details for d1ng5a_

PDB Entry: 1ng5 (more details), 2 Å

PDB Description: 2.0 a crystal structure of staphylococcus aureus sortase b
PDB Compounds: (A:) sortase B

SCOPe Domain Sequences for d1ng5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng5a_ b.100.1.1 (A:) Sortase B {Staphylococcus aureus [TaxId: 1280]}
qeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgktnh
dylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfyekh
kiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdvnvtv
kdkimtlstcedaysettkrivvvakiikvs

SCOPe Domain Coordinates for d1ng5a_:

Click to download the PDB-style file with coordinates for d1ng5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ng5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ng5b_