Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.68: IF3-like [55199] (7 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.6: AlbA-like [82704] (2 families) |
Family d.68.6.1: DNA-binding protein AlbA [82705] (1 protein) |
Protein DNA-binding protein AlbA [82706] (4 species) an archaeal chromatin protein modulated by acetylation, a Sir2 substrate |
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [103059] (2 PDB entries) gene AF1956 |
Domain d1nfja_: 1nfj A: [91866] |
PDB Entry: 1nfj (more details), 2 Å
SCOP Domain Sequences for d1nfja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfja_ d.68.6.1 (A:) DNA-binding protein AlbA {Archaeon Archaeoglobus fulgidus} ehvvyvgnkpvmnyvlatltqlnegadevvikargraisravdvaeivrnrfmpgvkvke ikidteeleseqgrrsnvstieivlak
Timeline for d1nfja_: