Lineage for d1nfja_ (1nfj A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 505944Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 506066Superfamily d.68.6: AlbA-like [82704] (2 families) (S)
  5. 506067Family d.68.6.1: DNA-binding protein AlbA [82705] (1 protein)
  6. 506068Protein DNA-binding protein AlbA [82706] (4 species)
    an archaeal chromatin protein modulated by acetylation, a Sir2 substrate
  7. 506069Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [103059] (2 PDB entries)
    gene AF1956
  8. 506070Domain d1nfja_: 1nfj A: [91866]

Details for d1nfja_

PDB Entry: 1nfj (more details), 2 Å

PDB Description: Structure of a Sir2 substrate, alba, reveals a mechanism for deactylation-induced enhancement of DNA-binding

SCOP Domain Sequences for d1nfja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfja_ d.68.6.1 (A:) DNA-binding protein AlbA {Archaeon Archaeoglobus fulgidus}
ehvvyvgnkpvmnyvlatltqlnegadevvikargraisravdvaeivrnrfmpgvkvke
ikidteeleseqgrrsnvstieivlak

SCOP Domain Coordinates for d1nfja_:

Click to download the PDB-style file with coordinates for d1nfja_.
(The format of our PDB-style files is described here.)

Timeline for d1nfja_: