Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.6: AlbA-like [82704] (3 families) |
Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins) |
Protein DNA-binding protein AlbA [82706] (4 species) an archaeal chromatin protein modulated by acetylation, a Sir2 substrate |
Species Archaeoglobus fulgidus [TaxId:2234] [103059] (2 PDB entries) gene AF1956 |
Domain d1nfhb_: 1nfh B: [91865] |
PDB Entry: 1nfh (more details), 2.65 Å
SCOPe Domain Sequences for d1nfhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfhb_ d.68.6.1 (B:) DNA-binding protein AlbA {Archaeoglobus fulgidus [TaxId: 2234]} hvvyvgnkpvmnyvlatltqlnegadevvikargraisravdvaeivrnrfmpgvkvkei kidteeleseqgrrsnvstieivlak
Timeline for d1nfhb_: