SCOP 1.67: Domain d1nfhb_: 1nfh B:

Lineage for d1nfhb_ (1nfh B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.68: IF3-like [55199] (7 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: DNA-binding protein AlbA [82704] (1 family)

5. Family d.68.6.1: DNA-binding protein AlbA [82705] (1 protein)

6. Protein DNA-binding protein AlbA [82706] (4 species)
   an archaeal chromatin protein modulated by acetylation, a Sir2 substrate

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [103059] (2 PDB entries)
   gene AF1956

8. Domain d1nfhb_: 1nfh B: [91865]

Details for d1nfhb_

PDB Entry: 1nfh, 2.65 Å

PDB Description: Structure of a Sir2 substrate, alba, reveals a mechanism for deactylation-induced enhancement of DNA-binding

SCOP Domain Sequences for d1nfhb_:

Sequence; same for both SEQRES and ATOM records:

>d1nfhb_ d.68.6.1 (B:) DNA-binding protein AlbA {Archaeon Archaeoglobus fulgidus}
hvvyvgnkpvmnyvlatltqlnegadevvikargraisravdvaeivrnrfmpgvkvkei
kidteeleseqgrrsnvstieivlak

Timeline for d1nfhb_:

• d1nfhb_ is new in SCOP 1.67
  
• d1nfhb_ appears in SCOP 1.69
  
• d1nfhb_ appears in the current release, SCOPe 2.08