Lineage for d1nfhb_ (1nfh B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2523683Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2524018Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2524019Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)
  6. 2524020Protein DNA-binding protein AlbA [82706] (4 species)
    an archaeal chromatin protein modulated by acetylation, a Sir2 substrate
  7. 2524021Species Archaeoglobus fulgidus [TaxId:2234] [103059] (2 PDB entries)
    gene AF1956
  8. 2524024Domain d1nfhb_: 1nfh B: [91865]

Details for d1nfhb_

PDB Entry: 1nfh (more details), 2.65 Å

PDB Description: Structure of a Sir2 substrate, alba, reveals a mechanism for deactylation-induced enhancement of DNA-binding
PDB Compounds: (B:) conserved hypothetical protein AF1956

SCOPe Domain Sequences for d1nfhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfhb_ d.68.6.1 (B:) DNA-binding protein AlbA {Archaeoglobus fulgidus [TaxId: 2234]}
hvvyvgnkpvmnyvlatltqlnegadevvikargraisravdvaeivrnrfmpgvkvkei
kidteeleseqgrrsnvstieivlak

SCOPe Domain Coordinates for d1nfhb_:

Click to download the PDB-style file with coordinates for d1nfhb_.
(The format of our PDB-style files is described here.)

Timeline for d1nfhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nfha_