Lineage for d1nfbb1 (1nfb B:10-111,B:232-498)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080657Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 2080658Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species)
  7. 2080665Species Human (Homo sapiens), type II [TaxId:9606] [51418] (3 PDB entries)
  8. 2080671Domain d1nfbb1: 1nfb B:10-111,B:232-498 [91861]
    Other proteins in same PDB: d1nfba4, d1nfbb4
    complexed with cpr, nad

Details for d1nfbb1

PDB Entry: 1nfb (more details), 2.9 Å

PDB Description: Ternary complex of the human type II Inosine Monophosphate Dedhydrogenase with 6Cl-IMP and NAD
PDB Compounds: (B:) Inosine-5'-monophosphate dehydrogenase 2

SCOPe Domain Sequences for d1nfbb1:

Sequence, based on SEQRES records: (download)

>d1nfbb1 c.1.5.1 (B:10-111,B:232-498) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens), type II [TaxId: 9606]}
tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
mdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeXdyplaskdakkqllcga
aigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqviggnvvtaa
qaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvpviadggiq
nvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldamdkhlssqn
ryfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvrammysgel
kfekrtssaq

Sequence, based on observed residues (ATOM records): (download)

>d1nfbb1 c.1.5.1 (B:10-111,B:232-498) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens), type II [TaxId: 9606]}
tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
mdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeXdyplaskdakkqllcga
aigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqviggnvvtaa
qaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvpviadggiq
nvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmdkgsihkfvpylia
giqhscqdigaksltqvrammysgelkfekrtssaq

SCOPe Domain Coordinates for d1nfbb1:

Click to download the PDB-style file with coordinates for d1nfbb1.
(The format of our PDB-style files is described here.)

Timeline for d1nfbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nfbb4