![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.37: CBS-domain [54630] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.37.1: CBS-domain [54631] (1 family) ![]() |
![]() | Family d.37.1.1: CBS-domain [54632] (4 proteins) pairs of CBS domains dimerize to form a stable globular domain |
![]() | Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species) contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals |
![]() | Species Human (Homo sapiens), type II [TaxId:9606] [54634] (3 PDB entries) |
![]() | Domain d1nfba2: 1nfb A:112-152 [91859] Other proteins in same PDB: d1nfba1, d1nfbb1 |
PDB Entry: 1nfb (more details), 2.9 Å
SCOP Domain Sequences for d1nfba2:
Sequence, based on SEQRES records: (download)
>d1nfba2 d.37.1.1 (A:112-152) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II} qgfitdpvvlspkdrvrdvfeakarhgfcgipitdtgrmgs
>d1nfba2 d.37.1.1 (A:112-152) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II} qgfitdpvvlspgipitdtgrmgs
Timeline for d1nfba2: