Lineage for d1nfba2 (1nfb A:112-152)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410626Fold d.37: CBS-domain [54630] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 410627Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 410628Family d.37.1.1: CBS-domain [54632] (4 proteins)
    pairs of CBS domains dimerize to form a stable globular domain
  6. 410643Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
    contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals
  7. 410652Species Human (Homo sapiens), type II [TaxId:9606] [54634] (3 PDB entries)
  8. 410659Domain d1nfba2: 1nfb A:112-152 [91859]
    Other proteins in same PDB: d1nfba1, d1nfbb1

Details for d1nfba2

PDB Entry: 1nfb (more details), 2.9 Å

PDB Description: Ternary complex of the human type II Inosine Monophosphate Dedhydrogenase with 6Cl-IMP and NAD

SCOP Domain Sequences for d1nfba2:

Sequence, based on SEQRES records: (download)

>d1nfba2 d.37.1.1 (A:112-152) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II}
qgfitdpvvlspkdrvrdvfeakarhgfcgipitdtgrmgs

Sequence, based on observed residues (ATOM records): (download)

>d1nfba2 d.37.1.1 (A:112-152) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II}
qgfitdpvvlspgipitdtgrmgs

SCOP Domain Coordinates for d1nfba2:

Click to download the PDB-style file with coordinates for d1nfba2.
(The format of our PDB-style files is described here.)

Timeline for d1nfba2: