Lineage for d1nf7b3 (1nf7 B:170-231)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502537Fold d.37: CBS-domain [54630] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 502538Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 502539Family d.37.1.1: CBS-domain [54632] (4 proteins)
    pairs of CBS domains dimerize to form a stable globular domain
  6. 502554Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
    contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals
  7. 502563Species Human (Homo sapiens), type II [TaxId:9606] [54634] (3 PDB entries)
  8. 502569Domain d1nf7b3: 1nf7 B:170-231 [91857]
    Other proteins in same PDB: d1nf7a1, d1nf7b1
    both CBS domains are partly disordered in both chains, A and B

Details for d1nf7b3

PDB Entry: 1nf7 (more details), 2.65 Å

PDB Description: Ternary complex of the human type II Inosine Monophosphate Dedhydrogenase with Ribavirin Monophosphate and C2-Mycophenolic Adenine Dinucleotide

SCOP Domain Sequences for d1nf7b3:

Sequence, based on SEQRES records: (download)

>d1nf7b3 d.37.1.1 (B:170-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II}
ehdcfleeimtkredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkk
nr

Sequence, based on observed residues (ATOM records): (download)

>d1nf7b3 d.37.1.1 (B:170-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II}
ehdcfleeimtkredlvvapagitlkeaneilqrskkgklpivneddelvaiiartlkkn
r

SCOP Domain Coordinates for d1nf7b3:

Click to download the PDB-style file with coordinates for d1nf7b3.
(The format of our PDB-style files is described here.)

Timeline for d1nf7b3: