SCOP 1.69: Domain d1nf7b2: 1nf7 B:112-166

Lineage for d1nf7b2 (1nf7 B:112-166)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (4 proteins)
   pairs of CBS domains dimerize to form a stable globular domain

6. Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
   contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals

7. Species Human (Homo sapiens), type II [TaxId:9606] [54634] (3 PDB entries)

8. Domain d1nf7b2: 1nf7 B:112-166 [91856]
   Other proteins in same PDB: d1nf7a1, d1nf7b1

Details for d1nf7b2

PDB Entry: 1nf7, 2.65 Å

PDB Description: Ternary complex of the human type II Inosine Monophosphate Dedhydrogenase with Ribavirin Monophosphate and C2-Mycophenolic Adenine Dinucleotide

SCOP Domain Sequences for d1nf7b2:

Sequence, based on SEQRES records:

>d1nf7b2 d.37.1.1 (B:112-166) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II}
qgfitdpvvlspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidfl

Sequence, based on observed residues (ATOM records):

>d1nf7b2 d.37.1.1 (B:112-166) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II}
qgfitdpvvlspkgiissrdidfl

Timeline for d1nf7b2:

• d1nf7b2 first appeared in SCOP 1.67
  
• d1nf7b2 appears in SCOP 1.71
  
• d1nf7b2 last appears in SCOP 1.73