Lineage for d1nf7b1 (1nf7 B:10-111,B:232-514)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570835Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (1 family) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 570836Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 570837Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (6 species)
  7. 570844Species Human (Homo sapiens), type II [TaxId:9606] [51418] (3 PDB entries)
  8. 570848Domain d1nf7b1: 1nf7 B:10-111,B:232-514 [91855]
    Other proteins in same PDB: d1nf7a2, d1nf7a3, d1nf7b2, d1nf7b3
    complexed with k, myd, rvp

Details for d1nf7b1

PDB Entry: 1nf7 (more details), 2.65 Å

PDB Description: Ternary complex of the human type II Inosine Monophosphate Dedhydrogenase with Ribavirin Monophosphate and C2-Mycophenolic Adenine Dinucleotide

SCOP Domain Sequences for d1nf7b1:

Sequence, based on SEQRES records: (download)

>d1nf7b1 c.1.5.1 (B:10-111,B:232-514) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens), type II}
tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
mdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeXdyplaskdakkqllcga
aigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqviggnvvtaa
qaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvpviadggiq
nvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldamdkhlssqn
ryfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvrammysgel
kfekrtssaqveggvhslhsyekrlf

Sequence, based on observed residues (ATOM records): (download)

>d1nf7b1 c.1.5.1 (B:10-111,B:232-514) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens), type II}
tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
mdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeXdyplaskdakkqllcga
aigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqviggnvvtaa
qaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvpviadggiq
nvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldamikvaqgvs
gavqdkgsihkfvpyliagiqhscqdigaksltqvrammysgelkfekrtssaqveggvh
slhsyekrlf

SCOP Domain Coordinates for d1nf7b1:

Click to download the PDB-style file with coordinates for d1nf7b1.
(The format of our PDB-style files is described here.)

Timeline for d1nf7b1: