![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.37: CBS-domain [54630] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.37.1: CBS-domain [54631] (1 family) ![]() |
![]() | Family d.37.1.1: CBS-domain [54632] (10 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain |
![]() | Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species) contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals |
![]() | Species Human (Homo sapiens), type II [TaxId:9606] [54634] (3 PDB entries) |
![]() | Domain d1nf7a3: 1nf7 A:170-231 [91854] Other proteins in same PDB: d1nf7a1, d1nf7b1 |
PDB Entry: 1nf7 (more details), 2.65 Å
SCOP Domain Sequences for d1nf7a3:
Sequence, based on SEQRES records: (download)
>d1nf7a3 d.37.1.1 (A:170-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]} ehdcfleeimtkredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkk nr
>d1nf7a3 d.37.1.1 (A:170-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]} ehdcfleeimtkredlvvapagitlkeaneilqrskkgklpivneddelvaiiartlkkn r
Timeline for d1nf7a3: