SCOPe 2.07: Domain d1nf2c_: 1nf2 C:

Lineage for d1nf2c_ (1nf2 C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Hypothetical protein TM0651 [102313] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [102314] (1 PDB entry)

8. Domain d1nf2c_: 1nf2 C: [91851]
   structural genomics
   complexed with mg, so4

Details for d1nf2c_

PDB Entry: 1nf2, 2.2 Å

PDB Description: X-ray crystal structure of TM0651 from Thermotoga maritima

PDB Compounds: (C:) phosphatase

SCOPe Domain Sequences for d1nf2c_:

Sequence; same for both SEQRES and ATOM records:

>d1nf2c_ c.108.1.10 (C:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]}
myrvfvfdldgtllndnleisekdrrnieklsrkcyvvfasgrmlvstlnvekkyfkrtf
ptiayngaivylpeegvilnekippevakdiieyikplnvhwqayiddvlysekdneeik
syarhsnvdyrvepnlselvskmgttklllidtperldelkeilserfkdvvkvfksfpt
yleivpknvdkgkalrflrermnwkkeeivvfgdnendlfmfeeaglrvamenaiekvke
asdivtltnndsgvsyvleristdcld

Timeline for d1nf2c_:

• d1nf2c_ first appeared in SCOP 1.67
  
• d1nf2c_ appears in SCOPe 2.06
  
• d1nf2c_ appears in the current release, SCOPe 2.08