Lineage for d1nf2b_ (1nf2 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404418Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 404419Superfamily c.108.1: HAD-like [56784] (14 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 404529Family c.108.1.10: Predicted hydrolases Cof [82388] (4 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 404536Protein Hypothetical protein TM0651 [102313] (1 species)
  7. 404537Species Thermotoga maritima [TaxId:243274] [102314] (1 PDB entry)
  8. 404539Domain d1nf2b_: 1nf2 B: [91850]

Details for d1nf2b_

PDB Entry: 1nf2 (more details), 2.2 Å

PDB Description: X-ray crystal structure of TM0651 from Thermotoga maritima

SCOP Domain Sequences for d1nf2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nf2b_ c.108.1.10 (B:) Hypothetical protein TM0651 {Thermotoga maritima}
myrvfvfdldgtllndnleisekdrrnieklsrkcyvvfasgrmlvstlnvekkyfkrtf
ptiayngaivylpeegvilnekippevakdiieyikplnvhwqayiddvlysekdneeik
syarhsnvdyrvepnlselvskmgttklllidtperldelkeilserfkdvvkvfksfpt
yleivpknvdkgkalrflrermnwkkeeivvfgdnendlfmfeeaglrvamenaiekvke
asdivtltnndsgvsyvleristdcld

SCOP Domain Coordinates for d1nf2b_:

Click to download the PDB-style file with coordinates for d1nf2b_.
(The format of our PDB-style files is described here.)

Timeline for d1nf2b_: