SCOP 1.67: Domain d1neea1: 1nee A:1-98

Lineage for d1neea1 (1nee A:1-98)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.241: Ribosome binding domain-like [100965] (2 superfamilies)
   beta-(2)-alpha(2)-beta(2); 2 layers: beta/alpha; antiparallel beta-sheet: order 1243; topological similarity to the common core of ribosomal proteins L23 and L15e

4. Superfamily d.241.1: Translation initiation factor 2 beta, aIF2beta, N-terminal domain [100966] (1 family)

5. Family d.241.1.1: Translation initiation factor 2 beta, aIF2beta, N-terminal domain [100967] (1 protein)

6. Protein Translation initiation factor 2 beta, aIF2beta, N-terminal domain [100968] (2 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [102739] (1 PDB entry)

8. Domain d1neea1: 1nee A:1-98 [91841]
   Other proteins in same PDB: d1neea2
   complexed with zn

Details for d1neea1

PDB Entry: 1nee

PDB Description: structure of archaeal translation factor aif2beta from methanobacterium thermoautrophicum

SCOP Domain Sequences for d1neea1:

Sequence; same for both SEQRES and ATOM records:

>d1neea1 d.241.1.1 (A:1-98) Translation initiation factor 2 beta, aIF2beta, N-terminal domain {Archaeon Methanobacterium thermoautotrophicum}
mddyeklleraidqlppevfetkrfevpkaysviqgnrtfiqnfrevadalnrdpqhllk
fllrelgtagnleggrailqgkfthflineriedyvnk

Timeline for d1neea1:

• d1neea1 is new in SCOP 1.67
  
• d1neea1 appears in SCOP 1.69
  
• d1neea1 appears in the current release, SCOPe 2.08