![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.241: Ribosome binding domain-like [100965] (2 superfamilies) beta-(2)-alpha(2)-beta(2); 2 layers: beta/alpha; antiparallel beta-sheet: order 1243; topological similarity to the common core of ribosomal proteins L23 and L15e |
![]() | Superfamily d.241.1: Translation initiation factor 2 beta, aIF2beta, N-terminal domain [100966] (2 families) ![]() |
![]() | Family d.241.1.1: Translation initiation factor 2 beta, aIF2beta, N-terminal domain [100967] (1 protein) |
![]() | Protein Translation initiation factor 2 beta, aIF2beta, N-terminal domain [100968] (2 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [102739] (1 PDB entry) |
![]() | Domain d1neea1: 1nee A:1-98 [91841] Other proteins in same PDB: d1neea2 complexed with zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1nee (more details)
SCOPe Domain Sequences for d1neea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1neea1 d.241.1.1 (A:1-98) Translation initiation factor 2 beta, aIF2beta, N-terminal domain {Methanobacterium thermoautotrophicum [TaxId: 145262]} mddyeklleraidqlppevfetkrfevpkaysviqgnrtfiqnfrevadalnrdpqhllk fllrelgtagnleggrailqgkfthflineriedyvnk
Timeline for d1neea1: