![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) ![]() |
![]() | Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (2 proteins) duplication: consists of two NAT-like domains swapped with the C-terminal strands |
![]() | Protein Peptidyltransferase FemX [103177] (1 species) |
![]() | Species Weissella viridescens [TaxId:1629] [103178] (2 PDB entries) |
![]() | Domain d1ne9a1: 1ne9 A:1-164 [91839] |
PDB Entry: 1ne9 (more details), 1.7 Å
SCOP Domain Sequences for d1ne9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ne9a1 d.108.1.4 (A:1-164) Peptidyltransferase FemX {Weissella viridescens} pvlnlndpqaveryeefmrqspygqvtqdlgwakvknnwepvdvyleddqgaiiaamsml lgdtptdkkfayaskgpvmdvtdvdlldrlvdeavkaldgrayvlrfdpevaysdefntt lqdhgyvtrnrnvadagmhatiqprlnmvldltkfpdakttldl
Timeline for d1ne9a1: