Lineage for d1ne9a1 (1ne9 A:1-164)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416835Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 416836Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) (S)
  5. 416999Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (2 proteins)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 417004Protein Peptidyltransferase FemX [103177] (1 species)
  7. 417005Species Weissella viridescens [TaxId:1629] [103178] (2 PDB entries)
  8. 417006Domain d1ne9a1: 1ne9 A:1-164 [91839]

Details for d1ne9a1

PDB Entry: 1ne9 (more details), 1.7 Å

PDB Description: Crystal Structure of Weissella viridescens FemX at 1.7 Ang Resolution

SCOP Domain Sequences for d1ne9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ne9a1 d.108.1.4 (A:1-164) Peptidyltransferase FemX {Weissella viridescens}
pvlnlndpqaveryeefmrqspygqvtqdlgwakvknnwepvdvyleddqgaiiaamsml
lgdtptdkkfayaskgpvmdvtdvdlldrlvdeavkaldgrayvlrfdpevaysdefntt
lqdhgyvtrnrnvadagmhatiqprlnmvldltkfpdakttldl

SCOP Domain Coordinates for d1ne9a1:

Click to download the PDB-style file with coordinates for d1ne9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ne9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ne9a2