Lineage for d1ne7b_ (1ne7 B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713168Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 713169Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (7 families) (S)
  5. 713170Family c.124.1.1: NagB-like [52513] (2 proteins)
    share a common phosphate-binding site with the RpiA family
  6. 713175Protein Glucosamine 6-phosphate deaminase/isomerase NagB [52514] (2 species)
  7. 713193Species Human (Homo sapiens) [TaxId:9606] [102320] (1 PDB entry)
  8. 713195Domain d1ne7b_: 1ne7 B: [91834]

Details for d1ne7b_

PDB Entry: 1ne7 (more details), 1.75 Å

PDB Description: human glucosamine-6-phosphate deaminase isomerase at 1.75 a resolution complexed with n-acetyl-glucosamine-6-phosphate and 2-deoxy-2-amino- glucitol-6-phosphate
PDB Compounds: (B:) Glucosamine-6-phosphate isomerase

SCOP Domain Sequences for d1ne7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ne7b_ c.124.1.1 (B:) Glucosamine 6-phosphate deaminase/isomerase NagB {Human (Homo sapiens) [TaxId: 9606]}
mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
edatlelkvktvkyfkglmlvhnklvdplysike

SCOP Domain Coordinates for d1ne7b_:

Click to download the PDB-style file with coordinates for d1ne7b_.
(The format of our PDB-style files is described here.)

Timeline for d1ne7b_: