![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase [100950] (4 families) ![]() |
![]() | Family c.124.1.1: NagB-like [52513] (2 proteins) share a common phosphate-binding site with the RpiA family |
![]() | Protein Glucosamine 6-phosphate deaminase/isomerase NagB [52514] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102320] (1 PDB entry) |
![]() | Domain d1ne7b_: 1ne7 B: [91834] |
PDB Entry: 1ne7 (more details), 1.75 Å
SCOP Domain Sequences for d1ne7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ne7b_ c.124.1.1 (B:) Glucosamine 6-phosphate deaminase/isomerase NagB {Human (Homo sapiens)} mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd edatlelkvktvkyfkglmlvhnklvdplysike
Timeline for d1ne7b_: