Lineage for d1ndza_ (1ndz A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683612Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 683613Family c.1.9.1: Adenosine/AMP deaminase [51557] (2 proteins)
  6. 683614Protein Adenosine deaminase (ADA) [51558] (3 species)
    Common fold covers the whole protein structure
  7. 683615Species Cow (Bos taurus) [TaxId:9913] [82257] (16 PDB entries)
  8. 683619Domain d1ndza_: 1ndz A: [91827]
    complexed with fr5, zn

Details for d1ndza_

PDB Entry: 1ndz (more details), 2 Å

PDB Description: Crystal Structure of Adenosine Deaminase Complexed with FR235999
PDB Compounds: (A:) adenosine deaminase

SCOP Domain Sequences for d1ndza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndza_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Cow (Bos taurus) [TaxId: 9913]}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr

SCOP Domain Coordinates for d1ndza_:

Click to download the PDB-style file with coordinates for d1ndza_.
(The format of our PDB-style files is described here.)

Timeline for d1ndza_: