![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily) consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation |
![]() | Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) ![]() automatically mapped to Pfam PF00632 |
![]() | Family d.148.1.1: Hect, E3 ligase catalytic domain [56205] (3 proteins) |
![]() | Protein WW domain-containing protein 1, WWP1 [103308] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103309] (1 PDB entry) |
![]() | Domain d1nd7a1: 1nd7 A:545-917 [91817] Other proteins in same PDB: d1nd7a2 |
PDB Entry: 1nd7 (more details), 2.1 Å
SCOPe Domain Sequences for d1nd7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nd7a1 d.148.1.1 (A:545-917) WW domain-containing protein 1, WWP1 {Human (Homo sapiens) [TaxId: 9606]} mgfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrrrlyvifrgee gldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhlsyfcfigrfi amalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnnieecglemyf svdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtkafldgfnevv plqwlqyfdekelevmlcgmqevdladwqrntvyrhytrnskqiiwfwqfvketdnevrm rllqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrldlppyksyeq lkekllfaieete
Timeline for d1nd7a1: