Lineage for d1nd7a1 (1nd7 A:545-917)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. Family d.148.1.1: Hect, E3 ligase catalytic domain [56205] (3 proteins)
  6. Protein WW domain-containing protein 1, WWP1 [103308] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [103309] (1 PDB entry)
  8. Domain d1nd7a1: 1nd7 A:545-917 [91817]
    Other proteins in same PDB: d1nd7a2

Details for d1nd7a1

PDB Entry: 1nd7 (more details), 2.1 Å

PDB Description: Conformational Flexibility Underlies Ubiquitin Ligation Mediated by the WWP1 HECT domain E3 Ligase
PDB Compounds: (A:) WW domain-containing protein 1

SCOPe Domain Sequences for d1nd7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nd7a1 d.148.1.1 (A:545-917) WW domain-containing protein 1, WWP1 {Human (Homo sapiens) [TaxId: 9606]}
mgfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrrrlyvifrgee
gldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhlsyfcfigrfi
amalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnnieecglemyf
svdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtkafldgfnevv
plqwlqyfdekelevmlcgmqevdladwqrntvyrhytrnskqiiwfwqfvketdnevrm
rllqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrldlppyksyeq
lkekllfaieete

SCOPe Domain Coordinates for d1nd7a1 are not available.

Timeline for d1nd7a1:

Domains from same chain:
(mouse over for more information)
d1nd7a2