SCOP 1.71: Domain d1nd1a_: 1nd1 A:

Lineage for d1nd1a_ (1nd1 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.9: Reprolysin-like [55519] (2 proteins)
   Pfam 01421

6. Protein Snake venom metalloprotease [55520] (7 species)

7. Species Terciopelo (Bothrops asper), bap1 [TaxId:8722] [103127] (1 PDB entry)

8. Domain d1nd1a_: 1nd1 A: [91808]
   complexed with zn

Details for d1nd1a_

PDB Entry: 1nd1, 1.93 Å

PDB Description: amino acid sequence and crystal structure of bap1, a metalloproteinase from bothrops asper snake venom that exerts multiple tissue-damaging activities.

SCOP Domain Sequences for d1nd1a_:

Sequence; same for both SEQRES and ATOM records:

>d1nd1a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1}
erfspryielavvadhgiftkynsnlntirtrvhemlntvngfyrsvdvhaplanlevws
kqdlikvqkdssktlksfgewrerdllprishdhaqlltavvfdgntigraytggmcdpr
hsvgvvrdhsknnlwvavtmahelghnlgidhdtgscscgakscimasvlskvlsyefsd
csqnqyetyltnhnpqcilnkp

Timeline for d1nd1a_:

• d1nd1a_ first appeared in SCOP 1.67
  
• d1nd1a_ appears in SCOP 1.69
  
• d1nd1a_ appears in SCOP 1.73
  
• d1nd1a_ appears in the current release, SCOPe 2.08