Lineage for d1nd1a_ (1nd1 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415443Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 415444Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 415608Family d.92.1.9: Hemorrhagin [55519] (1 protein)
  6. 415609Protein Snake venom metalloprotease [55520] (6 species)
  7. 415625Species Terciopelo (Bothrops asper), bap1 [TaxId:8722] [103127] (1 PDB entry)
  8. 415626Domain d1nd1a_: 1nd1 A: [91808]
    complexed with zn

Details for d1nd1a_

PDB Entry: 1nd1 (more details), 1.93 Å

PDB Description: amino acid sequence and crystal structure of bap1, a metalloproteinase from bothrops asper snake venom that exerts multiple tissue-damaging activities.

SCOP Domain Sequences for d1nd1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nd1a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1}
erfspryielavvadhgiftkynsnlntirtrvhemlntvngfyrsvdvhaplanlevws
kqdlikvqkdssktlksfgewrerdllprishdhaqlltavvfdgntigraytggmcdpr
hsvgvvrdhsknnlwvavtmahelghnlgidhdtgscscgakscimasvlskvlsyefsd
csqnqyetyltnhnpqcilnkp

SCOP Domain Coordinates for d1nd1a_:

Click to download the PDB-style file with coordinates for d1nd1a_.
(The format of our PDB-style files is described here.)

Timeline for d1nd1a_: