SCOPe 2.05: Domain d1ncrc_: 1ncr C:

Lineage for d1ncrc_ (1ncr C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Rhinovirus coat proteins [49670] (5 species)

7. Species Human rhinovirus 16, (HRV-16) [TaxId:31708] [49672] (9 PDB entries)

8. Domain d1ncrc_: 1ncr C: [91807]
   complexed with myr, w11, zn

Details for d1ncrc_

PDB Entry: 1ncr, 2.7 Å

PDB Description: The structure of Rhinovirus 16 when complexed with pleconaril, an antiviral compound

PDB Compounds: (C:) coat protein vp3

SCOPe Domain Sequences for d1ncrc_:

Sequence; same for both SEQRES and ATOM records:

>d1ncrc_ b.121.4.1 (C:) Rhinovirus coat proteins {Human rhinovirus 16, (HRV-16) [TaxId: 31708]}
glpvyvtpgsgqfmttddmqspcalpwyhptkeifipgevknliemcqvdtlipinstqs
nignvsmytvtlspqtklaeeifaikvdiashplattligeiasyfthwtgslrfsfmfc
gtanttlkvllaytppgigkprsrkeamlgthvvwdvglqstvslvvpwisasqyrfttp
dtyssagyitcwyqtnfvvppntpntaemlcfvsgckdfclrmardtdlhkqtgpitq

Timeline for d1ncrc_:

• d1ncrc_ first appeared in SCOP 1.67
  
• d1ncrc_ appears in SCOPe 2.04
  
• d1ncrc_ appears in SCOPe 2.06
  
• d1ncrc_ appears in the current release, SCOPe 2.08