Lineage for d1nc4c2 (1nc4 C:111-215)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 656556Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 656560Species Human (Homo sapiens) [TaxId:9606] [88572] (43 PDB entries)
  8. 656580Domain d1nc4c2: 1nc4 C:111-215 [91794]
    Other proteins in same PDB: d1nc4a1, d1nc4b1, d1nc4b2, d1nc4c1, d1nc4d1, d1nc4d2
    part of Fab 2d12.5
    complexed with cl, dof, gd3, nag

Details for d1nc4c2

PDB Entry: 1nc4 (more details), 2.25 Å

PDB Description: Crystal Structure of Monoclonal Antibody 2D12.5 Fab Complexed with Gd-DOTA
PDB Compounds: (C:) monoclonal antibody 2d12.5, lambda light chain

SCOP Domain Sequences for d1nc4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nc4c2 b.1.1.2 (C:111-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslspaecs

SCOP Domain Coordinates for d1nc4c2:

Click to download the PDB-style file with coordinates for d1nc4c2.
(The format of our PDB-style files is described here.)

Timeline for d1nc4c2: