Lineage for d1nc2d2 (1nc2 D:121-221)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655466Domain d1nc2d2: 1nc2 D:121-221 [91788]
    Other proteins in same PDB: d1nc2a1, d1nc2a2, d1nc2b1, d1nc2c1, d1nc2c2, d1nc2d1
    part of Fab 2d12.5
    complexed with cl, doe, nag, yt3

Details for d1nc2d2

PDB Entry: 1nc2 (more details), 2.1 Å

PDB Description: Crystal Structure of Monoclonal Antibody 2D12.5 Fab Complexed with Y-DOTA
PDB Compounds: (D:) monoclonal antibody 2d12.5, igg1 gamma heavy chain

SCOP Domain Sequences for d1nc2d2:

Sequence, based on SEQRES records: (download)

>d1nc2d2 b.1.1.2 (D:121-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Sequence, based on observed residues (ATOM records): (download)

>d1nc2d2 b.1.1.2 (D:121-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpsstwpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1nc2d2:

Click to download the PDB-style file with coordinates for d1nc2d2.
(The format of our PDB-style files is described here.)

Timeline for d1nc2d2: