Lineage for d1nc2c2 (1nc2 C:111-215)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 454411Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 454415Species Human (Homo sapiens) [TaxId:9606] [88572] (42 PDB entries)
  8. 454429Domain d1nc2c2: 1nc2 C:111-215 [91786]
    Other proteins in same PDB: d1nc2a1, d1nc2b1, d1nc2b2, d1nc2c1, d1nc2d1, d1nc2d2
    part of Fab 2d12.5

Details for d1nc2c2

PDB Entry: 1nc2 (more details), 2.1 Å

PDB Description: Crystal Structure of Monoclonal Antibody 2D12.5 Fab Complexed with Y-DOTA

SCOP Domain Sequences for d1nc2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nc2c2 b.1.1.2 (C:111-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslspaecs

SCOP Domain Coordinates for d1nc2c2:

Click to download the PDB-style file with coordinates for d1nc2c2.
(The format of our PDB-style files is described here.)

Timeline for d1nc2c2: