Lineage for d1nc2a2 (1nc2 A:111-211)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 366115Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 366119Species Human (Homo sapiens) [TaxId:9606] [88572] (42 PDB entries)
  8. 366132Domain d1nc2a2: 1nc2 A:111-211 [91782]
    Other proteins in same PDB: d1nc2a1, d1nc2b1, d1nc2b2, d1nc2c1, d1nc2d1, d1nc2d2

Details for d1nc2a2

PDB Entry: 1nc2 (more details), 2.1 Å

PDB Description: Crystal Structure of Monoclonal Antibody 2D12.5 Fab Complexed with Y-DOTA

SCOP Domain Sequences for d1nc2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nc2a2 b.1.1.2 (A:111-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsp

SCOP Domain Coordinates for d1nc2a2:

Click to download the PDB-style file with coordinates for d1nc2a2.
(The format of our PDB-style files is described here.)

Timeline for d1nc2a2: