| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
| Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins) |
| Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (1 species) |
| Species Escherichia coli [TaxId:562] [82449] (6 PDB entries) |
| Domain d1nc1a_: 1nc1 A: [91779] |
PDB Entry: 1nc1 (more details), 2 Å
SCOP Domain Sequences for d1nc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nc1a_ c.56.2.1 (A:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli [TaxId: 562]}
fsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalg
atlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpag
fkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeatai
ahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg
Timeline for d1nc1a_: