Lineage for d1nbuh_ (1nbu H:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416305Fold d.96: T-fold [55619] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 416306Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 416451Family d.96.1.3: DHN aldolase/epimerase [55628] (2 proteins)
    beta-sheets of four subunits form a barrel, closed: n=16, S=16
  6. 416452Protein 7,8-dihydroneopterin aldolase [55629] (2 species)
  7. 416453Species Bacteria (Mycobacterium tuberculosis) [TaxId:1773] [103143] (1 PDB entry)
  8. 416461Domain d1nbuh_: 1nbu H: [91774]
    complexed with hhp; mutant

Details for d1nbuh_

PDB Entry: 1nbu (more details), 1.6 Å

PDB Description: 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis

SCOP Domain Sequences for d1nbuh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbuh_ d.96.1.3 (H:) 7,8-dihydroneopterin aldolase {Bacteria (Mycobacterium tuberculosis)}
adrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasra
aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr

SCOP Domain Coordinates for d1nbuh_:

Click to download the PDB-style file with coordinates for d1nbuh_.
(The format of our PDB-style files is described here.)

Timeline for d1nbuh_: