Lineage for d1nbub_ (1nbu B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919500Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1919501Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 1919693Family d.96.1.3: DHN aldolase/epimerase [55628] (2 proteins)
    beta-sheets of four subunits form a barrel, closed: n=16, S=16
    automatically mapped to Pfam PF02152
  6. 1919694Protein 7,8-dihydroneopterin aldolase [55629] (4 species)
  7. 1919698Species Mycobacterium tuberculosis [TaxId:1773] [103143] (2 PDB entries)
    Uniprot O06275 2-115
  8. 1919700Domain d1nbub_: 1nbu B: [91768]
    complexed with ph2

Details for d1nbub_

PDB Entry: 1nbu (more details), 1.6 Å

PDB Description: 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis
PDB Compounds: (B:) Probable dihydroneopterin aldolase

SCOPe Domain Sequences for d1nbub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbub_ d.96.1.3 (B:) 7,8-dihydroneopterin aldolase {Mycobacterium tuberculosis [TaxId: 1773]}
adrielrgltvhgrhgvyahervagqrfvidvtvwidlaeaansddladtydyvrlasra
aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr

SCOPe Domain Coordinates for d1nbub_:

Click to download the PDB-style file with coordinates for d1nbub_.
(The format of our PDB-style files is described here.)

Timeline for d1nbub_: