Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.3: DHN aldolase/epimerase [55628] (2 proteins) beta-sheets of four subunits form a barrel, closed: n=16, S=16 automatically mapped to Pfam PF02152 |
Protein 7,8-dihydroneopterin aldolase [55629] (4 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [103143] (2 PDB entries) Uniprot O06275 2-115 |
Domain d1nbub_: 1nbu B: [91768] complexed with ph2 |
PDB Entry: 1nbu (more details), 1.6 Å
SCOPe Domain Sequences for d1nbub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbub_ d.96.1.3 (B:) 7,8-dihydroneopterin aldolase {Mycobacterium tuberculosis [TaxId: 1773]} adrielrgltvhgrhgvyahervagqrfvidvtvwidlaeaansddladtydyvrlasra aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
Timeline for d1nbub_: