Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.58: Ferredoxin-like [54861] (49 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (4 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins) |
Protein Cut A1 [89931] (4 species) |
Species Escherichia coli [TaxId:562] [102973] (1 PDB entry) |
Domain d1naqe_: 1naq E: [91765] |
PDB Entry: 1naq (more details), 1.7 Å
SCOP Domain Sequences for d1naqe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1naqe_ d.58.5.2 (E:) Cut A1 {Escherichia coli} sntasvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyevqmil kttvshqqalleclkshhpyqtpellvlpvthgdtdylswlnasl
Timeline for d1naqe_: