SCOPe 2.05: Domain d1naqc_: 1naq C:

Lineage for d1naqc_ (1naq C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Cut A1 [89931] (5 species)

7. Species Escherichia coli [TaxId:562] [102973] (5 PDB entries)

8. Domain d1naqc_: 1naq C: [91763]
   complexed with hg, mbo

Details for d1naqc_

PDB Entry: 1naq, 1.7 Å

PDB Description: crystal structure of cuta1 from e.coli at 1.7 a resolution

PDB Compounds: (C:) Periplasmic divalent cation tolerance protein cutA

SCOPe Domain Sequences for d1naqc_:

Sequence; same for both SEQRES and ATOM records:

>d1naqc_ d.58.5.2 (C:) Cut A1 {Escherichia coli [TaxId: 562]}
ntasvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyevqmilk
ttvshqqalleclkshhpyqtpellvlpvthgdtdylswlnaslr

Timeline for d1naqc_:

• d1naqc_ first appeared in SCOP 1.67
  
• d1naqc_ appears in SCOPe 2.04
  
• d1naqc_ appears in SCOPe 2.06
  
• d1naqc_ appears in the current release, SCOPe 2.08