SCOP 1.67: Domain d1naqa_: 1naq A:

Lineage for d1naqa_ (1naq A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)

6. Protein Cut A1 [89931] (4 species)

7. Species Escherichia coli [TaxId:562] [102973] (1 PDB entry)

8. Domain d1naqa_: 1naq A: [91761]

Details for d1naqa_

PDB Entry: 1naq, 1.7 Å

PDB Description: crystal structure of cuta1 from e.coli at 1.7 a resolution

SCOP Domain Sequences for d1naqa_:

Sequence; same for both SEQRES and ATOM records:

>d1naqa_ d.58.5.2 (A:) Cut A1 {Escherichia coli}
sntasvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyevqmil
kttvshqqalleclkshhpyqtpellvlpvthgdtdylswlnaslr

Timeline for d1naqa_:

• d1naqa_ is new in SCOP 1.67
  
• d1naqa_ appears in SCOP 1.69
  
• d1naqa_ appears in the current release, SCOPe 2.08