Lineage for d1nakl2 (1nak L:108-212)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454323Domain d1nakl2: 1nak L:108-212 [91758]
    Other proteins in same PDB: d1nakh1, d1nakh2, d1naki1, d1naki2, d1nakl1, d1nakm1

Details for d1nakl2

PDB Entry: 1nak (more details), 2.57 Å

PDB Description: igg1 fab fragment (83.1) complex with 16-residue peptide (residues 304-321 of hiv-1 gp120 (mn isolate))

SCOP Domain Sequences for d1nakl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nakl2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d1nakl2:

Click to download the PDB-style file with coordinates for d1nakl2.
(The format of our PDB-style files is described here.)

Timeline for d1nakl2: