Lineage for d1nakl2 (1nak L:108-212)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2023413Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2023645Species Mouse (Mus musculus) [TaxId:10090] [88567] (355 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2024037Domain d1nakl2: 1nak L:108-212 [91758]
    Other proteins in same PDB: d1nakh1, d1nakh2, d1naki1, d1naki2, d1nakl1, d1nakm1
    part of Fab 83.1 against HIV-1 gp120

Details for d1nakl2

PDB Entry: 1nak (more details), 2.57 Å

PDB Description: igg1 fab fragment (83.1) complex with 16-residue peptide (residues 304-321 of hiv-1 gp120 (mn isolate))
PDB Compounds: (L:) Fab 83.1 - light chain

SCOPe Domain Sequences for d1nakl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nakl2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d1nakl2:

Click to download the PDB-style file with coordinates for d1nakl2.
(The format of our PDB-style files is described here.)

Timeline for d1nakl2: