Lineage for d1nakh2 (1nak H:114-229)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453694Domain d1nakh2: 1nak H:114-229 [91754]
    Other proteins in same PDB: d1nakh1, d1naki1, d1nakl1, d1nakl2, d1nakm1, d1nakm2

Details for d1nakh2

PDB Entry: 1nak (more details), 2.57 Å

PDB Description: igg1 fab fragment (83.1) complex with 16-residue peptide (residues 304-321 of hiv-1 gp120 (mn isolate))

SCOP Domain Sequences for d1nakh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nakh2 b.1.1.2 (H:114-229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1nakh2:

Click to download the PDB-style file with coordinates for d1nakh2.
(The format of our PDB-style files is described here.)

Timeline for d1nakh2: