Lineage for d1na6b1 (1na6 B:4-178)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2088905Fold b.142: DNA-binding pseudobarrel domain [101935] (1 superfamily)
    core: barrel, open; n=7, S*=10; capped with helices at both ends; partial similarity to the AbrB/MazE/MraZ-like fold (89446)
  4. 2088906Superfamily b.142.1: DNA-binding pseudobarrel domain [101936] (2 families) (S)
  5. 2088907Family b.142.1.1: Type II restriction endonuclease effector domain [101937] (1 protein)
    automatically mapped to Pfam PF09217
  6. 2088908Protein Restriction endonuclease EcoRII, N-terminal domain [101938] (1 species)
  7. 2088909Species Escherichia coli [TaxId:562] [101939] (1 PDB entry)
  8. 2088911Domain d1na6b1: 1na6 B:4-178 [91750]
    Other proteins in same PDB: d1na6a2, d1na6b2
    mutant

Details for d1na6b1

PDB Entry: 1na6 (more details), 2.1 Å

PDB Description: crystal structure of restriction endonuclease ecorii mutant r88a
PDB Compounds: (B:) Restriction endonuclease EcoRII

SCOPe Domain Sequences for d1na6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1na6b1 b.142.1.1 (B:4-178) Restriction endonuclease EcoRII, N-terminal domain {Escherichia coli [TaxId: 562]}
svfhnwlleiacenyfvyikrlsandtgatgghqvglyipsgiveklfpsinhtrelnps
vfltahvsshdcpdsearaiyynsahfgktrnekritrwgrgsplqdpentgaltllafk
ldeqggdckevniwvcastdeedvietaigevipgalisgpagqilgglslqqap

SCOPe Domain Coordinates for d1na6b1:

Click to download the PDB-style file with coordinates for d1na6b1.
(The format of our PDB-style files is described here.)

Timeline for d1na6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1na6b2