Lineage for d1na6a1 (1na6 A:4-178)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383605Fold b.142: Type II restriction endonuclease effector domain [101935] (1 superfamily)
    core: twisted 7-stranded beta-sheet (half-barrel) of complex topology
  4. 383606Superfamily b.142.1: Type II restriction endonuclease effector domain [101936] (1 family) (S)
  5. 383607Family b.142.1.1: Type II restriction endonuclease effector domain [101937] (1 protein)
  6. 383608Protein Restriction endonuclease EcoRII, N-terminal domain [101938] (1 species)
  7. 383609Species Escherichia coli [TaxId:562] [101939] (1 PDB entry)
  8. 383610Domain d1na6a1: 1na6 A:4-178 [91748]
    Other proteins in same PDB: d1na6a2, d1na6b2

Details for d1na6a1

PDB Entry: 1na6 (more details), 2.1 Å

PDB Description: crystal structure of restriction endonuclease ecorii mutant r88a

SCOP Domain Sequences for d1na6a1:

Sequence, based on SEQRES records: (download)

>d1na6a1 b.142.1.1 (A:4-178) Restriction endonuclease EcoRII, N-terminal domain {Escherichia coli}
svfhnwlleiacenyfvyikrlsandtgatgghqvglyipsgiveklfpsinhtrelnps
vfltahvsshdcpdsearaiyynsahfgktrnekritrwgrgsplqdpentgaltllafk
ldeqggdckevniwvcastdeedvietaigevipgalisgpagqilgglslqqap

Sequence, based on observed residues (ATOM records): (download)

>d1na6a1 b.142.1.1 (A:4-178) Restriction endonuclease EcoRII, N-terminal domain {Escherichia coli}
svfhnwlleiacenyfvyikrlsandtgatqvglyipsgiveklfpsinhtrelnpsvfl
tahvsshdcpdsearaiyynsahfgktrnekritrwgrgsplqdpentgaltllafklde
qggdckevniwvcastdeedvietaigevipgalisgpagqilgglslqqap

SCOP Domain Coordinates for d1na6a1:

Click to download the PDB-style file with coordinates for d1na6a1.
(The format of our PDB-style files is described here.)

Timeline for d1na6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1na6a2