SCOP 1.67: Domain d1na1a_: 1na1 A:

Lineage for d1na1a_ (1na1 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (9 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Rhinovirus coat proteins [49670] (5 species)

7. Species Human rhinovirus B 14 (HRV-14) [TaxId:12131] [49671] (30 PDB entries)

8. Domain d1na1a_: 1na1 A: [91743]
   complexed with w11

Details for d1na1a_

PDB Entry: 1na1, 3.3 Å

PDB Description: the structure of hrv14 when complexed with pleconaril

SCOP Domain Sequences for d1na1a_:

Sequence; same for both SEQRES and ATOM records:

>d1na1a_ b.121.4.1 (A:) Rhinovirus coat proteins {Human rhinovirus B 14 (HRV-14)}
tvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhfngsetdvecflgraac
vhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelftyvrfdseytilatasq
pdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkvgdtsrfsvpyvglasa
yncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvkirvyhrakhveawipr
apralpytsigrtnypkntepvikkrkgdiksy

Timeline for d1na1a_:

• d1na1a_ is new in SCOP 1.67
  
• d1na1a_ appears in SCOP 1.69
  
• d1na1a_ appears in the current release, SCOPe 2.08