SCOP 1.75: Domain d1n9yd_: 1n9y D:

Lineage for d1n9yd_ (1n9y D:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)

8. Domain d1n9yd_: 1n9y D: [91741]
   complexed with mpd; mutant

Details for d1n9yd_

PDB Entry: 1n9y, 1.53 Å

PDB Description: streptavidin mutant s27a at 1.5a resolution

PDB Compounds: (D:) streptavidin

SCOP Domain Sequences for d1n9yd_:

Sequence; same for both SEQRES and ATOM records:

>d1n9yd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgatfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

Timeline for d1n9yd_:

• d1n9yd_ first appeared in SCOP 1.67
  
• d1n9yd_ appears in SCOP 1.73
  
• d1n9yd_ appears in SCOPe 2.01
  
• d1n9yd_ appears in the current release, SCOPe 2.08