Lineage for d1n9md_ (1n9m D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415302Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2415334Protein Streptavidin [50878] (1 species)
  7. 2415335Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2415561Domain d1n9md_: 1n9m D: [91737]
    complexed with btn; mutant

Details for d1n9md_

PDB Entry: 1n9m (more details), 1.6 Å

PDB Description: streptavidin mutant s27a with biotin at 1.6a resolution
PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d1n9md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9md_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgatfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOPe Domain Coordinates for d1n9md_:

Click to download the PDB-style file with coordinates for d1n9md_.
(The format of our PDB-style files is described here.)

Timeline for d1n9md_: