Lineage for d1n9md_ (1n9m D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378912Fold b.61: Streptavidin-like [50875] (6 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 378913Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 378914Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 378937Protein Streptavidin [50878] (1 species)
  7. 378938Species Streptomyces avidinii [TaxId:1895] [50879] (113 PDB entries)
  8. 378969Domain d1n9md_: 1n9m D: [91737]
    complexed with btn; mutant

Details for d1n9md_

PDB Entry: 1n9m (more details), 1.6 Å

PDB Description: streptavidin mutant s27a with biotin at 1.6a resolution

SCOP Domain Sequences for d1n9md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9md_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgatfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOP Domain Coordinates for d1n9md_:

Click to download the PDB-style file with coordinates for d1n9md_.
(The format of our PDB-style files is described here.)

Timeline for d1n9md_: