Lineage for d1n9mb_ (1n9m B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1800830Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1800831Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1800832Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1800855Protein Streptavidin [50878] (1 species)
  7. 1800856Species Streptomyces avidinii [TaxId:1895] [50879] (124 PDB entries)
  8. 1800917Domain d1n9mb_: 1n9m B: [91735]
    complexed with btn; mutant

Details for d1n9mb_

PDB Entry: 1n9m (more details), 1.6 Å

PDB Description: streptavidin mutant s27a with biotin at 1.6a resolution
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1n9mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9mb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgatfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk

SCOPe Domain Coordinates for d1n9mb_:

Click to download the PDB-style file with coordinates for d1n9mb_.
(The format of our PDB-style files is described here.)

Timeline for d1n9mb_: